PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0358s0019.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 372aa    MW: 40641.1 Da    PI: 5.8144
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0358s0019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.98.8e-33203260259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C vkk+vers +dp++v++tYeg+H+h+
  Kalax.0358s0019.1.p 203 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCGVKKRVERSCTDPSTVVTTYEGKHTHP 260
                          8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-34187262IPR003657WRKY domain
SuperFamilySSF1182909.68E-29194262IPR003657WRKY domain
PROSITE profilePS5081132.225197262IPR003657WRKY domain
SMARTSM007747.8E-38202261IPR003657WRKY domain
PfamPF031064.7E-26203260IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MMKKEAMESL ISGGSDTSSL CYLDLLGGGA AGYGNLCSMF DGGVVNGAGA DLGFLEMLGV  60
QEFQIPMGYM FDEMAHSGEV MTSSWQAISI DQVPAAGYNN GFVKPMNKRQ QQPLFDDRNN  120
NAPGTPNSSS ISYASNNEGM VVESEQDDKA DEEEDEEEDG DDAEDQKGSG KSKKQLKAKK  180
GKLKKQRQPR IAFMTKSEVD HLEDGYRWRK YGQKAVKNSP FPRSYYRCTS ASCGVKKRVE  240
RSCTDPSTVV TTYEGKHTHP SPLTPRSISS ASFPDSAAFA ALPSLMHMNN LHSHYGHQLP  300
SSSFASPFNC NSYPMHSLTT SPAAPPNFNS FTPSPYNNNN ENVTSKPNQS VLRDHGLLQD  360
LIPSPVRKEE E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-29192262777Probable WRKY transcription factor 4
1wj2_A3e-29192262777Probable WRKY transcription factor 4
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-48WRKY DNA-binding protein 23